PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10013887m
Common NameCARUB_v10013887mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 397aa    MW: 44332.8 Da    PI: 7.9982
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10013887mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.1e-1856103148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
  Carubv10013887m  56 KGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNYL 103
                      79********************************************97 PP

2Myb_DNA-binding54.33.1e-17109154148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Carubv10013887m 109 RGKFTVQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 154
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-2647106IPR009057Homeodomain-like
PROSITE profilePS5129418.62951103IPR017930Myb domain
SuperFamilySSF466896.74E-3153150IPR009057Homeodomain-like
SMARTSM007171.7E-1455105IPR001005SANT/Myb domain
PfamPF002498.3E-1756103IPR001005SANT/Myb domain
CDDcd001671.07E-1158103No hitNo description
PROSITE profilePS5129426.753104158IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-26107158IPR009057Homeodomain-like
SMARTSM007172.6E-17108156IPR001005SANT/Myb domain
PfamPF002491.8E-16109154IPR001005SANT/Myb domain
CDDcd001676.16E-12111154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MPIHVRDREK GRLQNLNRDI FCCVSPSIYQ SDAKGAAFVI IIMGRSPCCD KAGLKKGPWT  60
PEEDQKLLAY IEEHGHGSWR SLPEKAGLQR CGKSCRLRWT NYLRPDIKRG KFTVQEEQTI  120
IQLHALLGNR WSAIATHLPK RTDNEIKNYW NTHLKKRLLK MGIDPVTHKH KNETLSSSTG  180
QSKNAATLSH MAQWESARLE AEARLARESK LLHLQHYQNN NLNKSGPQHC FTHKTSTNWT  240
KPNEGSGDQQ LESPTSTVTF SENLPLMIMP LGIPTDNRNR NNNNESSELP AMIEFAVSSS  300
TSSDVSLVKE HEHDWIRQIN CPCPTEGIGE GFTSLLLGDS VGRSLSTGKG EATASSVAGA  360
GVVSESEYNY YEDNKNYWNS ILNLVDSSPS DSQAMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26541585108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2493090.0AF249309.1 Arabidopsis thaliana putative transcription factor (MYB106) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296712.10.0hypothetical protein CARUB_v10013887mg
TrEMBLR0HW260.0R0HW26_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__117__AT3G01140.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.10.0myb domain protein 106